PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf01094g02006.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family WOX
Protein Properties Length: 380aa    MW: 42054.8 Da    PI: 7.7335
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf01094g02006.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox54.71.7e-1751111257
                               T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
                  Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                               ++R+++ +eq+++Le+ F++   +p ++e++++ +kl    ++ +++V++WFqNr+ + k+
  Niben101Scf01094g02006.1  51 KPRWNPRPEQIRILEAIFNSgMVNPPRDEIRKIRAKLqeygQVGDANVFYWFQNRKSRSKH 111
                               89*****************99*************************************995 PP

2Wus_type_Homeobox111.73.8e-3650113265
         Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                               +++RW+P+peQi+iLe++++sG+++P+++ei++i+a+L+eyG+++d+NVfyWFQNrk+R+++kq
  Niben101Scf01094g02006.1  50 PKPRWNPRPEQIRILEAIFNSGMVNPPRDEIRKIRAKLQEYGQVGDANVFYWFQNRKSRSKHKQ 113
                               689***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007110.38247112IPR001356Homeobox domain
SuperFamilySSF466894.19E-1247116IPR009057Homeodomain-like
SMARTSM003894.9E-949116IPR001356Homeobox domain
CDDcd000864.00E-850113No hitNo description
Gene3DG3DSA:1.10.10.601.4E-650119IPR009057Homeodomain-like
PfamPF000464.3E-1551111IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008284Biological Processpositive regulation of cell proliferation
GO:0030010Biological Processestablishment of cell polarity
GO:0048825Biological Processcotyledon development
GO:0090451Biological Processcotyledon boundary formation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 380 aa     Download sequence    Send to blast
MASSNRHWPS MFKSKPCNQW QHDINSSLIH QRAPCNPGGG VGCEERSPEP KPRWNPRPEQ  60
IRILEAIFNS GMVNPPRDEI RKIRAKLQEY GQVGDANVFY WFQNRKSRSK HKQRHLQNKA  120
QQTHNNTNIT SSHVTITAPT SSSSSSDKSS PNSTGHHKSS LTFSIGSANV MDLLNSPTAS  180
VNQQQNYNFQ CANNEFLSTE PFFFSVQPPT PTHSPAAITQ GFCIPDSTGF SHVSNSSGHL  240
FLSEWMGISQ TPSKKAEDEK INLQSQLNYA VTSAPTTNTH STVFPLTSTT IPTINHIQGL  300
VEPTDVGPTR STVFINDVAF EVGLGPFNVR EVFGDDAVLI HSSGEPLITN EWGLTLQPLQ  360
HGAFYYLLRT STPSNTIDLI
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009793302.10.0PREDICTED: WUSCHEL-related homeobox 9-like isoform X2
RefseqXP_016489291.10.0PREDICTED: WUSCHEL-related homeobox 9-like
TrEMBLA9XDF81e-178A9XDF8_PETHY; SISTER OF EVERGREEN
STRINGSolyc02g077390.1.11e-167(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA59422335
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G45980.13e-71WUSCHEL related homeobox 8